Product Browser

Last updated: 2014/4/14
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

ATG16L1 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00055054-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human ATG16L1 protein.
  • Immunogen:
  • ATG16L1 (NP_110430.4, 1 a.a. ~ 523 a.a) full-length human protein.
  • Sequence:
  • MAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ATG16L1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ATG16L1 expression in HeLa.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ATG16L1 expression in transfected 293T cell line (H00055054-T02) by ATG16L1 MaxPab polyclonal antibody.

    Lane 1: ATG16L1 transfected lysate(58.30 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of ATG16L1 transfected lysate using anti-ATG16L1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ATG16L1 purified MaxPab mouse polyclonal antibody (B01P) (H00055054-B01P).
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Gene Name:
  • ATG16L1
  • Gene Alias:
  • APG16L,ATG16L,FLJ00045,FLJ10035,FLJ10828,FLJ22677,IBD10,WDR30
  • Gene Description:
  • ATG16 autophagy related 16-like 1 (S. cerevisiae)
  • Gene Summary:
  • Autophagy is the major intracellular degradation system delivering cytoplasmic components to lysosomes, and it accounts for degradation of most long-lived proteins and some organelles. Cytoplasmic constituents, including organelles, are sequestered into double-membraned autophagosomes, which subsequently fuse with lysosomes. ATG16L1 is a component of a large protein complex essential for autophagy (Mizushima et al., 2003 [PubMed 12665549]).[supplied by OMIM
  • Other Designations:
  • APG16 autophagy 16-like,APG16L beta,ATG16 autophagy related 16-like protein 1,WD repeat domain 30
  • RSS
  • YouTube
  • Linkedin
  • Facebook