Product Browser

Last updated: 2014/4/21

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

IL20RB purified MaxPab mouse polyclonal antibody (B03P)MaxPab

  • Catalog # : H00053833-B03P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human IL20RB protein.
  • Immunogen:
  • IL20RB (ADZ15701.1, 1 a.a. ~ 147 a.a) full-length human protein.
  • Sequence:
  • MKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEERPFPWYWPCLPLLASC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Detection Antibody
  • Gene Information
  • Gene Name:
  • IL20RB
  • Gene Alias:
  • DIRS1,FNDC6,IL-20R2,MGC34923
  • Gene Description:
  • interleukin 20 receptor beta
  • Gene Summary:
  • IL20RB and IL20RA (MIM 605620) form a heterodimeric receptor for interleukin-20 (IL20; MIM 605619) (Blumberg et al., 2001 [PubMed 11163236]).[supplied by OMIM
  • Other Designations:
  • fibronectin type III domain containing 6,interleukin-20 receptor II
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook