NDUFA13 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human NDUFA13 protein.
Immunogen
NDUFA13 (AAH09189.1, 1 a.a. ~ 144 a.a) full-length human protein.
Sequence
MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
NDUFA13 MaxPab polyclonal antibody. Western Blot analysis of NDUFA13 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of NDUFA13 expression in transfected 293T cell line (H00051079-T02) by NDUFA13 MaxPab polyclonal antibody.
Lane 1: NDUFA13 transfected lysate(15.84 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to NDUFA13 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]Immunofluorescence
Immunofluorescence of purified MaxPab antibody to NDUFA13 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — NDUFA13
Entrez GeneID
51079GeneBank Accession#
BC009189Protein Accession#
AAH09189.1Gene Name
NDUFA13
Gene Alias
B16.6, CDA016, CGI-39, GRIM-19, GRIM19
Gene Description
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13
Omim ID
609435Gene Ontology
HyperlinkGene Summary
O
Other Designations
cell death-regulatory protein GRIM19
-
Interactome
-
Publication Reference
-
Differentially expressed proteins in malignant and benign adrenocortical tumors.
Kjellin H, Johansson H, Hoog A, Lehtio J, Jakobsson PJ, Kjellman M.
PLoS One 2014 Feb; 9(2):e87951.
Application:IHC-P, WB-Ti, Human, Benign, Malignant adrenal tumors.
-
Differentially expressed proteins in malignant and benign adrenocortical tumors.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com