PIK3R4 monoclonal antibody (M03), clone 1G12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PIK3R4.
Immunogen
PIK3R4 (NP_055417, 1259 a.a. ~ 1358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PIK3R4 monoclonal antibody (M03), clone 1G12 Western Blot analysis of PIK3R4 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of PIK3R4 expression in transfected 293T cell line by PIK3R4 monoclonal antibody (M03), clone 1G12.
Lane 1: PIK3R4 transfected lysate(153.103 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PIK3R4 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — PIK3R4
Entrez GeneID
30849GeneBank Accession#
NM_014602Protein Accession#
NP_055417Gene Name
PIK3R4
Gene Alias
MGC102700, VPS15, p150
Gene Description
phosphoinositide-3-kinase, regulatory subunit 4
Omim ID
602610Gene Ontology
HyperlinkGene Summary
O
Other Designations
phosphatidylinositol 3-kinase-associated p150|phosphoinositide-3-kinase, regulatory subunit 4, p150
-
Interactome
-
Pathway
-
Publication Reference
-
Loss of RUBCN/rubicon in adipocytes mediates the upregulation of autophagy to promote the fasting response.
Tadashi Yamamuro, Shuhei Nakamura, Kyosuke Yanagawa, Ayaka Tokumura, Tsuyoshi Kawabata, Atsunori Fukuhara, Hirofumi Teranishi, Maho Hamasaki, Iichiro Shimomura, Tamotsu Yoshimori.
Autophagy 2022 Mar; 1:11.
Application:WB-Ce, Human, Mouse, 3T3-L1, Hela cells.
-
Class III PI3K regulates organismal glucose homeostasis by providing negative feedback on hepatic insulin signalling.
Nemazanyy I, Montagnac G, Russell RC, Morzyglod L, Burnol AF, Guan KL, Pende M, Panasyuk G.
Nature Communications 2015 Sep; 6:8283.
Application:WB-Ce, Mouse, Hepa1.6 cells, hepatocytes.
-
Autophagy requires endoplasmic reticulum targeting of the PI3-kinase complex via Atg14L.
Matsunaga K, Morita E, Saitoh T, Akira S, Ktistakis NT, Izumi T, Noda T, Yoshimori T.
The Journal of Cell Biology 2010 Aug; 190(4):511.
Application:WB-Tr, Human, HEK 293 cells.
-
Loss of RUBCN/rubicon in adipocytes mediates the upregulation of autophagy to promote the fasting response.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com