Product Browser

Last updated: 2014/4/14
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

PIK3R4 monoclonal antibody (M01A), clone 1D4

  • Catalog # : H00030849-M01A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant PIK3R4.
  • Immunogen:
  • PIK3R4 (NP_055417, 1259 a.a. ~ 1358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00030849-M01A
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PIK3R4 monoclonal antibody (M01A), clone 1D4 Western Blot analysis of PIK3R4 expression in HeLa ( Cat # L013V1 ).
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PIK3R4 expression in transfected 293T cell line by PIK3R4 monoclonal antibody (M01A), clone 1D4.

    Lane 1: PIK3R4 transfected lysate(153.1 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PIK3R4
  • Gene Alias:
  • MGC102700,VPS15,p150
  • Gene Description:
  • phosphoinositide-3-kinase, regulatory subunit 4
  • Other Designations:
  • phosphatidylinositol 3-kinase-associated p150,phosphoinositide-3-kinase, regulatory subunit 4, p150
  • RSS
  • YouTube
  • Linkedin
  • Facebook