Product Browser

Last updated: 2014/4/21
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

BSCL2 polyclonal antibody (A02)

  • Catalog # : H00026580-A02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant BSCL2.
  • Immunogen:
  • BSCL2 (NP_116056, 263 a.a. ~ 354 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • WPRHRFSLQVNIRKRDNSRKEVQRRISAHQPGPEGQEESTPQSDVTEDGESPEDPSGTEGQLSEEEKPDQQPLSGEEELEPEASDGSGSWED
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00026580-A02
    Western Blot detection against Immunogen (36.23 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • BSCL2 polyclonal antibody (A02). Western Blot analysis of BSCL2 expression in Jurkat.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of BSCL2 expression in transfected 293T cell line by BSCL2 polyclonal antibody (A02).

    Lane1:BSCL2 transfected lysate (Predicted MW: 44.5 KDa).
    Lane2:Non-transfected lysate.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • BSCL2
  • Gene Alias:
  • GNG3LG,HMN5,MGC4694,SPG17
  • Gene Description:
  • Bernardinelli-Seip congenital lipodystrophy 2 (seipin)
  • Gene Summary:
  • This gene encodes protein seipin, which is located in the endoplasmic reticulum and may be important for lipid droplet morphology. Mutations in this gene have been associated with congenital generalized lipodystrophy type 2 or Berardinelli-Seip syndrome, a rare autosomal recessive disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • seipin
  • RSS
  • YouTube
  • Linkedin
  • Facebook