TRIM32 monoclonal antibody (M09), clone 2E5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TRIM32.
Immunogen
TRIM32 (NP_036342, 105 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RRLPRQFCRSCGLVLCEPCREADHQPPGHCTLPVKEAAEERRRDFGEKLTRLRELMGELQRRKAALEGVSKDLQARYKAVLQEYGHEERRVQDELARSRK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TRIM32 expression in transfected 293T cell line by TRIM32 monoclonal antibody (M09), clone 2E5.
Lane 1: TRIM32 transfected lysate(72 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TRIM32 is approximately 0.3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TRIM32 over-expressed 293 cell line, cotransfected with TRIM32 Validated Chimera RNAi ( Cat # H00022954-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIM32 monoclonal antibody (M09), clone 2E5 (Cat # H00022954-M09 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to TRIM32 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — TRIM32
Entrez GeneID
22954GeneBank Accession#
NM_012210Protein Accession#
NP_036342Gene Name
TRIM32
Gene Alias
BBS11, HT2A, LGMD2H, TATIP
Gene Description
tripartite motif-containing 32
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes. [provided by RefSeq
Other Designations
Limb-girdle muscular dystrophy 2H|OTTHUMP00000022763|TAT-interactive protein, 72-KD|limb girdle muscular dystrophy 2H (autosomal recessive)|muscular dystrophy, Hutterite type|tripartite motif protein TRIM32|zinc-finger protein HT2A
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
A complex of the ubiquitin ligase TRIM32 and the deubiquitinase USP7 balances the level of c-Myc ubiquitination and thereby determines neural stem cell fate specification.
Nicklas S, Hillje AL, Okawa S, Rudolph IM, Collmann FM, van Wuellen T, Del Sol A, Schwamborn JC.
Cell Death and Differentiation 2018 Jun; [Epub].
Application:IF, IHC, WB-Tr, Human, Mouse, HEK 293T cells, Mouse brain sections.
-
The ubiquitin ligase tripartite-motif-protein 32 is induced in Duchenne muscular dystrophy.
Assereto S, Piccirillo R, Baratto S, Scudieri P, Fiorillo C, Massacesi M, Traverso M, Galietta LJ, Bruno C, Minetti C, Zara F, Gazzerro E.
Laboratory Investigation 2016 Aug; 96(8):862.
Application:IF, Human, Skeletal muscle.
-
TRIM32 modulates pluripotency entry and exit by directly regulating Oct4 stability.
Bahnassawy L, Perumal TM, Gonzalez-Cano L, Hillje AL, Taher L, Makalowski W, Suzuki Y, Fuellen G, Sol AD, Schwamborn JC.
Scientific Reports 2015 Aug; 5:13456.
Application:IF, Mouse, Blastocysts.
-
Polarized and Stage-Dependent Distribution of Immunoreactivity for Novel PDZ-Binding Protein Preso1 in Adult Neurogenic Regions.
Lee ES, Kim WR, Kim Y, Lee HW, Kim H, Sun W.
Endocrinology and Metabolism (Seoul, Korea) 2014 Sep; 29(3):349.
Application:IF, Mouse, Neural stem cells.
-
Nuclear factor kappa B signaling initiates early differentiation of neural stem cells.
Zhang Y, Liu J, Yao S, Li F, Xin L, Lai M, Bracchi-Ricard V, Xu H, Yen W, Meng W, Liu S, Yang L, Karmally S, Liu J, Zhu H, Gordon J, Khalili K, Srinivasan S, Bethea JR, Mo X, Hu W.
Stem Cells 2012 Mar; 30(3):510.
Application:IF, Mouse, Neural stem cells.
-
TRIM32 Regulates Skeletal Muscle Stem Cell Differentiation and Is Necessary for Normal Adult Muscle Regeneration.
Nicklas S, Otto A, Wu X, Miller P, Stelzer S, Wen Y, Kuang S, Wrogemann K, Patel K, Ding H, Schwamborn JC.
PLoS One 2012 Jan; 7(1):e30445.
Application:IF, Mouse, Mouse satellite cell.
-
TRIM32 promotes neural differentiation through retinoic acid receptor-mediated transcription.
Sato T, Okumura F, Kano S, Kondo T, Ariga T, Hatakeyama S.
Journal of Cell Science 2011 Oct; 124(Pt 20):3492.
Application:WB-Tr, Human, HEK293T cells.
-
The TRIM-NHL Protein TRIM32 Activates MicroRNAs and Prevents Self-Renewal in Mouse Neural Progenitors.
Schwamborn JC, Berezikov E, Knoblich JA.
Cell 2009 Mar; 136(5):913.
Application:IF, IHC, Mouse, Mouse brains.
-
A complex of the ubiquitin ligase TRIM32 and the deubiquitinase USP7 balances the level of c-Myc ubiquitination and thereby determines neural stem cell fate specification.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com