AGR2 monoclonal antibody (M05), clone 1C9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
AGR2 monoclonal antibody (M05), clone 1C9. Western Blot analysis of AGR2 expression in human colon.
Western Blot (Transfected lysate)
Western Blot analysis of AGR2 expression in transfected 293T cell line by AGR2 monoclonal antibody (M05), clone 1C9.
Lane 1: AGR2 transfected lysate(20 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AGR2 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (44.99 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant AGR2.
Immunogen
AGR2 (AAH15503.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (44.99 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
AGR2 monoclonal antibody (M05), clone 1C9. Western Blot analysis of AGR2 expression in human colon.Western Blot (Transfected lysate)
Western Blot analysis of AGR2 expression in transfected 293T cell line by AGR2 monoclonal antibody (M05), clone 1C9.
Lane 1: AGR2 transfected lysate(20 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AGR2 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — AGR2
Entrez GeneID
10551GeneBank Accession#
BC015503Protein Accession#
AAH15503.1Gene Name
AGR2
Gene Alias
AG2, GOB-4, HAG-2, XAG-2
Gene Description
anterior gradient homolog 2 (Xenopus laevis)
Omim ID
606358Gene Ontology
HyperlinkOther Designations
anterior gradient 2 homolog|secreted cement gland homolog
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com