AGR2 monoclonal antibody (M02), clone 3G1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
AGR2 monoclonal antibody (M02), clone 3G1. Western Blot analysis of AGR2 expression in MCF-7 ( Cat # L046V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of AGR2 expression in transfected 293T cell line by AGR2 monoclonal antibody (M02), clone 3G1.
Lane 1: AGR2 transfected lysate(20 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AGR2 is approximately 3ng/ml as a capture antibody.
Western Blot detection against Immunogen (44.99 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant AGR2.
Immunogen
AGR2 (AAH15503.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (44.99 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
AGR2 monoclonal antibody (M02), clone 3G1. Western Blot analysis of AGR2 expression in MCF-7 ( Cat # L046V1 ).Western Blot (Transfected lysate)
Western Blot analysis of AGR2 expression in transfected 293T cell line by AGR2 monoclonal antibody (M02), clone 3G1.
Lane 1: AGR2 transfected lysate(20 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AGR2 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — AGR2
Entrez GeneID
10551GeneBank Accession#
BC015503Protein Accession#
AAH15503.1Gene Name
AGR2
Gene Alias
AG2, GOB-4, HAG-2, XAG-2
Gene Description
anterior gradient homolog 2 (Xenopus laevis)
Omim ID
606358Gene Ontology
HyperlinkOther Designations
anterior gradient 2 homolog|secreted cement gland homolog
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com