AGR2 monoclonal antibody (M01), clone 1E5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant AGR2.
Immunogen
AGR2 (AAH15503.1, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (44.99 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
AGR2 monoclonal antibody (M01), clone 1E5. Western Blot analysis of AGR2 expression in human colon.Western Blot (Cell lysate)
AGR2 monoclonal antibody (M01), clone 1E5. Western Blot analysis of AGR2 expression in MCF-7 ( Cat # L046V1 ).Western Blot (Transfected lysate)
Western Blot analysis of AGR2 expression in transfected 293T cell line by AGR2 monoclonal antibody (M01), clone 1E5.
Lane 1: AGR2 transfected lysate(20 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AGR2 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — AGR2
Entrez GeneID
10551GeneBank Accession#
BC015503Protein Accession#
AAH15503.1Gene Name
AGR2
Gene Alias
AG2, GOB-4, HAG-2, XAG-2
Gene Description
anterior gradient homolog 2 (Xenopus laevis)
Omim ID
606358Gene Ontology
HyperlinkOther Designations
anterior gradient 2 homolog|secreted cement gland homolog
-
Interactome
-
Disease
-
Publication Reference
-
The Nlrp6 inflammasome is not required for baseline colonic inner mucus layer formation or function.
Volk JK, Nyström EEL, van der Post S, Abad BM, Schroeder BO, Johansson Å, Svensson F, Jäverfelt S, Johansson MEV, Hansson GC, Birchenough GMH.
The Journal of Experimental Medicine 2019 Nov; 216(11):2602.
Application:IF, Mouse, Distal colon.
-
Control of anterior GRadient 2 (AGR2) dimerization links endoplasmic reticulum proteostasis to inflammation.
Maurel M, Obacz J, Avril T, Ding YP, Papadodima O, Treton X, Daniel F, Pilalis E, Hörberg J, Hou W, Beauchamp MC, Tourneur-Marsille J, Cazals-Hatem D, Sommerova L, Samali A, Tavernier J, Hrstka R, Dupont A, Fessart D, Delom F, Fernandez-Zapico ME, Jansen G, Eriksson LA, Thomas DY, Jerome-Majewska L, Hupp T, Chatziioannou A, Chevet E, Ogier-Denis E.
EMBO Molecular Medicine 2019 Jun; 11(6):e10120.
Application:IP, WB-Tr, Human, HEK 293T cells, Intestinal epithelial cells.
-
AGR2, an Endoplasmic Reticulum Protein, Is Secreted into the Gastrointestinal Mucus.
Bergstrom JH, Berg KA, Rodriguez-Pineiro AM, Stecher B, Johansson ME, Hansson GC.
PLoS One 2014 Aug; 9(8):e104186.
Application:WB, Hamster, CHO-K1 cells.
-
The Nlrp6 inflammasome is not required for baseline colonic inner mucus layer formation or function.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com