AKT3 monoclonal antibody (M04), clone 4C1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant AKT3.
Immunogen
AKT3 (AAD29089, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDE
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
AKT3 monoclonal antibody (M04), clone 4C1 Western Blot analysis of AKT3 expression in MCF-7 ( Cat # L046V1 ).Western Blot (Cell lysate)
AKT3 monoclonal antibody (M04), clone 4C1. Western Blot analysis of AKT3 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
AKT3 monoclonal antibody (M04), clone 4C1. Western Blot analysis of AKT3 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AKT3 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — AKT3
Entrez GeneID
10000GeneBank Accession#
AF124141Protein Accession#
AAD29089Gene Name
AKT3
Gene Alias
DKFZp434N0250, PKB-GAMMA, PKBG, PRKBG, RAC-PK-gamma, RAC-gamma, STK-2
Gene Description
v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)
Omim ID
611223Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the AKT, also called PKB, serine/threonine protein kinase family. AKT kinases are known to be regulators of cell signaling in response to insulin and growth factors. They are involved in a wide variety of biological processes including cell proliferation, differentiation, apoptosis, tumorigenesis, as well as glycogen synthesis and glucose uptake. This kinase has been shown to be stimulated by platelet-derived growth factor (PDGF), insulin, and insulin-like growth factor 1 (IGF1). Alternatively splice transcript variants encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
OTTHUMP00000037911|OTTHUMP00000037912|RAC-gamma serine/threonine protein kinase|protein kinase B gamma|serine threonine protein kinase, Akt-3|v-akt murine thymoma viral oncogene homolog 3
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com