Product Browser

Last updated: 2015/5/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ABCG1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00009619-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ABCG1 partial ORF ( AAH29158, 21 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEGPWWRKKGYKTLLKGISGKFNSGELVAIMGPSGAGKSTLMNI
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.73
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009619-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9619
  • Gene Name:
  • ABCG1
  • Gene Alias:
  • ABC8,MGC34313,WHITE1
  • Gene Description:
  • ATP-binding cassette, sub-family G (WHITE), member 1
  • Gene Summary:
  • The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. It is involved in macrophage cholesterol and phospholipids transport, and may regulate cellular lipid homeostasis in other cell types. Six alternative splice variants have been identified. [provided by RefSeq
  • Other Designations:
  • ABC transporter 8,ATP-binding cassette sub-family G member 1,ATP-binding cassette transporter 8,ATP-binding cassette transporter member 1 of subfamily G,OTTHUMP00000109322,homolog of Drosophila white,white protein homolog (ATP-binding cassette transporter
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook