Product Browser

Last updated: 2015/8/30
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPT2 polyclonal antibody (A01)

  • Catalog # : H00009374-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PPT2.
  • Immunogen:
  • PPT2 (NP_005146, 203 a.a. ~ 302 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQSSFFGFYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYETCIEPWLS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009374-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9374
  • Gene Name:
  • PPT2
  • Gene Alias:
  • C6orf8,DKFZp564P1516,G14
  • Gene Description:
  • palmitoyl-protein thioesterase 2
  • Gene Summary:
  • This gene encodes a member of the palmitoyl-protein thioesterase family. The encoded glycosylated lysosomal protein has palmitoyl-CoA hydrolase activity in vitro, but does not hydrolyze palmitate from cysteine residues in proteins. Three transcript variants encoding different isoforms have been described for this gene, with one of the isoforms being inactive. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000029377,OTTHUMP00000029378,OTTHUMP00000029380,VE-statin2,palmitoyl-protein hydrolase 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook