ADIPOQ polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
ADIPOQ polyclonal antibody (A01). Western Blot analysis of ADIPOQ expression in rat adipocytes.
Western Blot detection against Immunogen (37.11 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant ADIPOQ.
Immunogen
ADIPOQ (NP_004788, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag.
Sequence
YRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQ
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (93); Rat (92)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ADIPOQ polyclonal antibody (A01). Western Blot analysis of ADIPOQ expression in rat adipocytes.Western Blot (Recombinant protein)
ELISA
-
Gene Info — ADIPOQ
Entrez GeneID
9370GeneBank Accession#
NM_004797Protein Accession#
NP_004788Gene Name
ADIPOQ
Gene Alias
ACDC, ACRP30, ADPN, APM-1, APM1, GBP28, adiponectin
Gene Description
adiponectin, C1Q and collagen domain containing
Omim ID
605441Gene Ontology
HyperlinkGene Summary
This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. [provided by RefSeq
Other Designations
adipocyte, C1Q and collagen domain containing|adipocyte, C1Q and collagen domain-containing|adiponectin|adipose most abundant gene transcript 1|gelatin-binding protein 28
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Grafted-double walled carbotn nanotubes as electrochemical platforms for immobilization of antibodies using a metallic-complex chelating polymer: Application to the determination of adiponectin cytokine in serum.
Ojeda I, Barrejón M, Arellano LM, González-Cortés A, Yáñez-Sedeño P, Langa F, Pingarrón JM.
Biosensors & Bioelectronics 2015 Dec; 74:24.
Application：ELISA, Human, Human serum.
-
Grafted-double walled carbotn nanotubes as electrochemical platforms for immobilization of antibodies using a metallic-complex chelating polymer: Application to the determination of adiponectin cytokine in serum.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com