Product Browser

Last updated: 2014/4/21
  • Related Product Showcase
  • By Antibody/Protein

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

APLN purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00008862-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human APLN protein.
  • Immunogen:
  • APLN (AAH21104.1, 1 a.a. ~ 122 a.a) full-length human protein.
  • Sequence:
  • MSATWCSPEGQGMGQGPGREVGGNSAASGPASPIRDPCLSEAGLKGPPSAHPRRLCLLHRLVCFSGGLTSIQLSPRTCCSHQWAQLFSPACFPQWRAPGCSLDDSRSLTRIRPVHLPGPSLD
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of APLN expression in transfected 293T cell line (H00008862-T01) by APLN MaxPab polyclonal antibody.

    Lane 1: APLN transfected lysate(13.53 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 8862
  • Gene Name:
  • APLN
  • Gene Alias:
  • XNPEP2
  • Gene Description:
  • apelin
  • Gene Summary:
  • Apelin is a neuropeptide expressed in the supraoptic and paraventricular nuclei that acts on specific receptors located on vasopressinergic neurons (De Mota et al., 2004) [PubMed 15231996].[supplied by OMIM
  • Other Designations:
  • apelin, AGTRL1 ligand,peptide ligand for APJ receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook