Product Browser

Last updated: 2014/4/14
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

RIPK2 polyclonal antibody (A01)

  • Catalog # : H00008767-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant RIPK2.
  • Immunogen:
  • RIPK2 (AAH04553, 431 a.a. ~ 540 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008767-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8767
  • Gene Name:
  • RIPK2
  • Gene Alias:
  • CARD3,CARDIAK,CCK,GIG30,RICK,RIP2
  • Gene Description:
  • receptor-interacting serine-threonine kinase 2
  • Gene Summary:
  • This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli. [provided by RefSeq
  • Other Designations:
  • CARD-carrying kinase,CARD-containing interleukin-1 beta-converting enzyme (ICE)-associated kinase,growth-inhibiting gene 30,receptor interacting protein 2,receptor-interacting protein (RIP)-like interacting caspase-like apoptosis regulatory protein (CLARP
  • RSS
  • YouTube
  • Linkedin
  • Facebook