ANP32A monoclonal antibody (M01), clone 2G11-4A5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ANP32A monoclonal antibody (M01), clone 2G11-4A5. Western Blot analysis of ANP32A expression in Daudi ( Cat # L001V1 ).
Western Blot (Cell lysate)
ANP32A monoclonal antibody (M01), clone 2G11-4A5 Western Blot analysis of ANP32A expression in Hela ( Cat # L013V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ANP32A on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 3 ug/ml]
Western Blot detection against Immunogen (53.13 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant ANP32A.
Immunogen
ANP32A (AAH07200, 1 a.a. ~ 249 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (53.13 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ANP32A monoclonal antibody (M01), clone 2G11-4A5. Western Blot analysis of ANP32A expression in Daudi ( Cat # L001V1 ).Western Blot (Cell lysate)
ANP32A monoclonal antibody (M01), clone 2G11-4A5 Western Blot analysis of ANP32A expression in Hela ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ANP32A on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 3 ug/ml]ELISA
-
Gene Info — ANP32A
Entrez GeneID
8125GeneBank Accession#
BC007200Protein Accession#
AAH07200Gene Name
ANP32A
Gene Alias
C15orf1, I1PP2A, LANP, MAPM, MGC119787, MGC150373, PHAP1, PHAPI, PP32
Gene Description
acidic (leucine-rich) nuclear phosphoprotein 32 family, member A
Omim ID
600832Gene Ontology
HyperlinkGene Summary
O
Other Designations
cerebellar leucine rich acidic nuclear protein|inhibitor-1 of protein phosphatase-2A|mapmodulin|putative human HLA class II associated protein I
-
Interactome
-
Disease
-
Publication Reference
-
Foamy viral nuclear RNA-export is distinct from other retroviruses.
Bodem J, Schied T, Gabriel R, Rammling M, Rethwilm A.
Journal of Virology 2011 Mar; 85(5):2333.
Application：WB, Human, HEK 293T cells.
-
Quantitative nano-proteomics for protein complexes (QNanoPX) related to estrogen transcriptional action.
Cheng PC, Chang HK, Chen SH.
Molecular & Cellular Proteomics 2010 Feb; 9(2):209.
Application：WB-Ce, Human, MCF-7 cells.
-
Foamy viral nuclear RNA-export is distinct from other retroviruses.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com