Product Browser

Last updated: 2014/4/21
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

YES1 monoclonal antibody (M02A), clone 3C6

  • Catalog # : H00007525-M02A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant YES1.
  • Immunogen:
  • YES1 (AAH48960, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007525-M02A
    Western Blot detection against Immunogen (34.54 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • YES1 monoclonal antibody (M02A), clone 3C6. Western Blot analysis of YES1 expression in Hela S3 NE ( Cat # L013V3 ).
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • YES1 monoclonal antibody (M02A), clone 3C6 Western Blot analysis of YES1 expression in Jurkat ( Cat # L017V1 ).
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7525
  • Gene Name:
  • YES1
  • Gene Alias:
  • HsT441,P61-YES,Yes,c-yes
  • Gene Description:
  • v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1
  • Gene Summary:
  • This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein has tyrosine kinase activity and belongs to the src family of proteins. This gene lies in close proximity to thymidylate synthase gene on chromosome 18, and a corresponding pseudogene has been found on chromosome 22. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000162194,Yamaguchi sarcoma oncogene,cellular yes-1 protein,proto-oncogene tyrosine-protein kinase YES,viral oncogene yes-1 homolog 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook