YES1 monoclonal antibody (M02), clone 3C6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
YES1 monoclonal antibody (M02), clone 3C6 Western Blot analysis of YES1 expression in Jurkat ( Cat # L017V1 ).
Western Blot (Cell lysate)
YES1 monoclonal antibody (M02), clone 3C6. Western Blot analysis of YES1 expression in Hela S3 NE ( Cat # L013V3 ).
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between PTK2B and YES1. Huh7 cells were stained with anti-PTK2B rabbit purified polyclonal 1:1200 and anti-YES1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot detection against Immunogen (34.54 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant YES1.
Immunogen
YES1 (AAH48960, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMTPFGGSSGVTPFGGASSSFSV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (73)
Isotype
IgG2b kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.54 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
YES1 monoclonal antibody (M02), clone 3C6 Western Blot analysis of YES1 expression in Jurkat ( Cat # L017V1 ).Western Blot (Cell lysate)
YES1 monoclonal antibody (M02), clone 3C6. Western Blot analysis of YES1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between PTK2B and YES1. Huh7 cells were stained with anti-PTK2B rabbit purified polyclonal 1:1200 and anti-YES1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — YES1
Entrez GeneID
7525GeneBank Accession#
BC048960Protein Accession#
AAH48960Gene Name
YES1
Gene Alias
HsT441, P61-YES, Yes, c-yes
Gene Description
v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1
Omim ID
164880Gene Ontology
HyperlinkGene Summary
This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein has tyrosine kinase activity and belongs to the src family of proteins. This gene lies in close proximity to thymidylate synthase gene on chromosome 18, and a corresponding pseudogene has been found on chromosome 22. [provided by RefSeq
Other Designations
OTTHUMP00000162194|Yamaguchi sarcoma oncogene|cellular yes-1 protein|proto-oncogene tyrosine-protein kinase YES|viral oncogene yes-1 homolog 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com