VRK1 monoclonal antibody (M02), clone 4F9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant VRK1.
Immunogen
VRK1 (NP_003375, 287 a.a. ~ 396 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of VRK1 expression in transfected 293T cell line by VRK1 monoclonal antibody (M02), clone 4F9.
Lane 1: VRK1 transfected lysate(45.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of VRK1 transfected lysate using anti-VRK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with VRK1 monoclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged VRK1 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of VRK1 over-expressed 293 cell line, cotransfected with VRK1 Validated Chimera RNAi ( Cat # H00007443-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with VRK1 monoclonal antibody (M02) clone 4F9 (Cat # H00007443-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to VRK1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — VRK1
Entrez GeneID
7443GeneBank Accession#
NM_003384Protein Accession#
NP_003375Gene Name
VRK1
Gene Alias
MGC117401, MGC138280, MGC142070
Gene Description
vaccinia related kinase 1
Omim ID
602168Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. This gene is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal liver, and carcinomas. Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 molecule and, in vitro, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination. This gene, therefore, may regulate cell proliferation. This protein also phosphorylates histone, casein, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN. [provided by RefSeq
Other Designations
vaccinia virus B1R-related kinase 1|vaccinia-related kinase-1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com