TNF monoclonal antibody (M03), clone M1-C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
TNF monoclonal antibody (M03), clone S2. Western Blot analysis of TNF expression in rat liver.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TNF on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TNF is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (51.37 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant TNF.
Immunogen
TNF (AAH28148, 1 a.a. ~ 233 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (79); Rat (78)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (51.37 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TNF monoclonal antibody (M03), clone S2. Western Blot analysis of TNF expression in rat liver.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TNF on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TNF is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — TNF
Entrez GeneID
7124GeneBank Accession#
BC028148Protein Accession#
AAH28148Gene Name
TNF
Gene Alias
DIF, TNF-alpha, TNFA, TNFSF2
Gene Description
tumor necrosis factor (TNF superfamily, member 2)
Gene Ontology
HyperlinkGene Summary
This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine. [provided by RefSeq
Other Designations
APC1 protein|OTTHUMP00000029281|OTTHUMP00000037669|TNF superfamily, member 2|TNF, macrophage-derived|TNF, monocyte-derived|cachectin|tumor necrosis factor alpha
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Inhibitory effects of epi-sesamin on endothelial protein C receptor shedding in vitro and in vivo.
Ku SK, Lee W, Yoo H, Han CK, Bae JS.
Inflammation Research 2013 Oct; 62(10):895.
-
Inhibitory effects of epi-sesamin on endothelial protein C receptor shedding in vitro and in vivo.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com