Product Browser

Last updated: 2014/4/21
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

KLF10 monoclonal antibody (M15), clone 1H3

  • Catalog # : H00007071-M15
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant KLF10.
  • Immunogen:
  • KLF10 (AAH11538.1, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • LSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVD
  • Host:
  • Mouse
  • Reactivity:
  • Human, Mouse, Rat
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007071-M15
    Western Blot detection against Immunogen (36.63 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • KLF10 monoclonal antibody (M15), clone 1H3. Western Blot analysis of KLF10 expression in human colon.
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • KLF10 monoclonal antibody (M15), clone 1H3. Western Blot analysis of KLF10 expression in PC-12(Cat # L012V1 ).
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • KLF10 monoclonal antibody (M15), clone 1H3. Western Blot analysis of KLF10 expression in A-549 ( Cat # L025V1 ).
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • KLF10 monoclonal antibody (M15), clone 1H3. Western Blot analysis of KLF10 expression in Raw 264.7(Cat # L024V1 ).
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • KLF10 monoclonal antibody (M15), clone 1H3. Western Blot analysis of KLF10 expression in Y-79 ( Cat # L042V1 ).
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • KLF10 monoclonal antibody (M15), clone 1H3. Western Blot analysis of KLF10 expression in Jurkat(Cat # L017V1 ).
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • KLF10 monoclonal antibody (M15), clone 1H3. Western Blot analysis of KLF10 expression in NIH/3T3(Cat # L018V1 ).
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7071
  • Gene Name:
  • KLF10
  • Gene Alias:
  • EGRA,TIEG,TIEG1
  • Gene Description:
  • Kruppel-like factor 10
  • Other Designations:
  • TGFB inducible early growth response
  • RSS
  • YouTube
  • Linkedin
  • Facebook