TFAM purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human TFAM protein.
Immunogen
TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein.
Sequence
MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (63)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TFAM MaxPab polyclonal antibody. Western Blot analysis of TFAM expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of TFAM expression in transfected 293T cell line (H00007019-T02) by TFAM MaxPab polyclonal antibody.
Lane 1: TFAM transfected lysate(27.06 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to TFAM on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Immunofluorescence
Immunofluorescence of purified MaxPab antibody to TFAM on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TFAM
Entrez GeneID
7019GeneBank Accession#
NM_003201.1Protein Accession#
NP_003192.1Gene Name
TFAM
Gene Alias
MtTF1, TCF6, TCF6L1, TCF6L2, TCF6L3, mtTFA
Gene Description
transcription factor A, mitochondrial
Omim ID
600438Gene Ontology
HyperlinkGene Summary
This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells. [provided by RefSeq
Other Designations
OTTHUMP00000019633|Transcription factor 6-like 2 (mitochondrial transcription factor)|mitochondrial transcription factor A
-
Interactome
-
Disease
-
Publication Reference
-
The mitochondrial ATP-dependent potassium channel (mitoKATP) controls skeletal muscle structure and function.
Giulia Di Marco, Gaia Gherardi, Agnese De Mario, Ilaria Piazza, Martina Baraldo, Andrea Mattarei, Bert Blaauw, Rosario Rizzuto, Diego De Stefani, Cristina Mammucari.
Cell Death & Disease 2024 Jan; 15(1):58.
Application:WB, Mice, Mitok−/− mice muscles.
-
Multiple assay systems to analyze the dynamics of mitochondrial nucleoids in living mammalian cells.
Takaya Ishihara, Hirotaka Kanon, Reiko Ban-Ishihara, Naotada Ishihara.
Biochimica et Biophysica acta. General Subjects 2021 Feb; 1865(7):129874.
Application:WB-Tr, Human, HeLa cells.
-
Impaired Mitochondrial Morphology and Functionality in Lonp1wt/- Mice.
Anna De Gaetano, Lara Gibellini, Elena Bianchini, Rebecca Borella, Sara De Biasi, Milena Nasi, Federica Boraldi, Andrea Cossarizza, Marcello Pinti.
Journal of Clinical Medicine 2020 Jun; 9(6):E1783.
Application:WB-Ce, WB-Ti, Mouse, Embryos, MEFs.
-
Hippocampal tau oligomerization early in tau pathology coincides with a transient alteration of mitochondrial homeostasis and DNA repair in a mouse model of tauopathy.
Zheng J, Akbari M, Schirmer C, Reynaert ML, Loyens A, Lefebvre B, Buée L, Croteau DL, Galas MC, Bohr VA.
Acta Neuropathologica Communications 2020 Mar; 8(1):25.
Application:WB-Ti, Mouse, Mouse hippocampus extracts.
-
Diminished OPA1 expression and impaired mitochondrial morphology and homeostasis in Aprataxin-deficient cells.
Zheng J, Croteau DL, Bohr VA, Akbari M.
Nucleic Acids Research 2019 May; 47(8):4086.
Application:WB-Tr, Human, U2OS cells.
-
AICAR induces mitochondrial apoptosis in human osteosarcoma cells through an AMPK-dependent pathway.
Morishita M, Kawamoto T, Hara H, Onishi Y, Ueha T, Minoda M, Katayama E, Takemori T, Fukase N, Kurosaka M, Kuroda R, Akisue T.
International Journal of Oncology 2017 Jan; 50(1):23.
Application:WB, Human, Osteosarcoma cell lines MG63, KHOS.
-
Decreased mitochondrial copy numbers in oral squamous cell carcinoma.
Takeda D, Hasegawa T, Ueha T, Sakakibara A, Kawamoto T, Minamikawa T, Sakai Y, Komori T.
Head Neck 2016 Apr; 38(8):1170.
Application:IHC-P, Human, Oral SCC.
-
Slow mitochondrial repair of 5'-AMP renders mtDNA susceptible to damage in APTX deficient cells.
Akbari M, Sykora P, Bohr VA.
Scientific Reports 2015 Aug; 5:12876.
Application:WB, Human, C3ABR, L938 lymphoblast cell lines.
-
Silencing of mitochondrial Lon protease deeply impairs mitochondrial proteome and function in colon cancer cells.
Gibellini L, Pinti M, Boraldi F, Giorgio V, Bernardi P, Bartolomeo R, Nasi M, De Biasi S, Missiroli S, Carnevale G, Losi L, Tesei A, Pinton P, Quaglino D, Cossarizza A.
FASEB Journal 2014 Dec; 28(12):5122.
Application:WB-Ce, Human, RKO cells.
-
Overexpression of DNA ligase III in mitochondria protects cells against oxidative stress and improves mitochondrial DNA base excision repair.
Akbari M, Keijzers G, Maynard S, Scheibye-Knudsen M, Desler C, Hickson ID, Bohr VA.
DNA Repair 2014 Apr; 16:44.
Application:WB-Ce, Human, HeLa, U2OS cells.
-
Impaired complex IV activity in response to loss of LRPPRC function can be compensated by mitochondrial hyperfusion.
Rolland SG, Motori E, Memar N, Hench J, Frank S, Winklhofer KF, Conradt B.
PNAS 2013 Aug; 110(32):E2967.
Application:WB-Tr, Human, SH-SY5Y cells.
-
Loss of mitochondrial peptidase Clpp leads to infertility, hearing loss plus growth retardation via accumulation of CLPX, mtDNA, and inflammatory factors.
Gispert S, Parganlija D, Klinkenberg M, Drose S, Wittig I, Mittelbronn M, Grzmil P, Koob S, Hamann A, Walter M, Buchel F, Adler T, de Angelis MH, Busch DH, Zell A, Reichert AS, Brandt U, Osiewacz HD, Jendrach M, Auburger G.
Human Molecular Genetics 2013 Dec; 22(24):4871.
Application:WB-Ti, Mouse, Brains, Hearts, Livers, Testis.
-
Tissue-specific control of mitochondrial respiration in obesity-related insulin resistance and diabetes.
Holmström MH, Iglesias-Gutierrez E, Zierath JR, Garcia-Roves PM.
American Journal of Physiology. Endocrinology and Metabolism 2012 Mar; 302(6):E731.
Application:WB-Ti, Mouse, Mouse skeletal muscle.
-
Cockayne syndrome group B protein promotes mitochondrial DNA stability by supporting the DNA repair association with the mitochondrial membrane.
Aamann MD, Sorensen MM, Hvitby C, Berquist BR, Muftuoglu M, Tian J, de Souza-Pinto NC, Scheibye-Knudsen M, Wilson Iii DM, Stevnsner T, Bohr VA.
FASEB Journal 2010 Jul; 24(7):2334.
Application:IF, Human, HeLa, Human fibroblast cells.
-
The mitochondrial ATP-dependent potassium channel (mitoKATP) controls skeletal muscle structure and function.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com