S100A9 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human S100A9 full-length ORF ( AAH47681, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENRNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
38.28
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — S100A9
Entrez GeneID
6280GeneBank Accession#
BC047681Protein Accession#
AAH47681Gene Name
S100A9
Gene Alias
60B8AG, CAGB, CFAG, CGLB, L1AG, LIAG, MAC387, MIF, MRP14, NIF, P14
Gene Description
S100 calcium binding protein A9
Omim ID
123886Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. [provided by RefSeq
Other Designations
OTTHUMP00000015331|S100 calcium-binding protein A9|S100 calcium-binding protein A9 (calgranulin B)|calgranulin B
-
Interactome
-
Disease
-
Publication Reference
-
Methods for predicting rheumatoid arthritis treatment response.
Olivier Vittecoq, Thierry Lequerre, Pascal Cosette, Olivier Boyer, Xavier Le Loet, Julie Hardouin, Antoine Obry.
United States Patent Application Publication 2016 May; [Epub].
Application:ELISA, Human, Serum.
-
Melanocyte and melanoma cell activation by calprotectin.
Shirley SH, von Maltzan K, Robbins PO, Kusewitt DF.
Journal of Skin Cancer 2014 Aug; 2014:846249.
Application:Cell Proliferation Assay, Human, Melanocyte, Melanoma cells.
-
CD14(+)S100A9(+) monocytic myeloid-derived suppressor cells and their clinical relevance in non-small cell lung cancer.
Feng PH, Lee KY, Chang YL, Chan YF, Kuo LW, Lin TY, Chung FT, Kuo CS, Yu CT, Lin SM, Wang CH, Chou CL, Huang CD, Kuo HP.
American Journal of Respiratory and Critical Care Medicine 2012 Nov; 186(10):1025.
Application:Func, Human, A-549 cells.
-
In vivo targeting of inflammation-associated myeloid-related protein 8/14 via gadolinium immunonanoparticles.
Maiseyeu A, Badgeley MA, Kampfrath T, Mihai G, Deiuliis JA, Liu C, Sun Q, Parthasarathy S, Simon DI, Croce K, Rajagopalan S.
Arteriosclerosis, Thrombosis, and Vascular Biology 2012 Apr; 32(4):962.
-
Lack of an Endogenous Anti-inflammatory Protein in Mice Enhances Colonization of B16F10 Melanoma Cells in the Lungs.
Saha A, Lee YC, Zhang Z, Chandra G, Su SB, Mukherjee AB.
The Journal of Biological Chemistry 2010 Apr; 285(14):10822.
Application:Func, Mouse, B16F10 cells.
-
Cationic polypeptides are required for anti-HIV-1 activity of human vaginal fluid.
Venkataraman N, Cole AL, Svoboda P, Pohl J, Cole AM.
Journal of Immunology 2005 Dec; 175(11):7560.
Application:WB, Human, Human vaginal fluid.
-
Methods for predicting rheumatoid arthritis treatment response.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com