RYK (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RYK partial ORF ( NP_002949, 54 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
ELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRNDLISHYALSFNLLVPSETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQVNISVQGEVPRTLSVFRVELSCTGKV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RYK
Entrez GeneID
6259GeneBank Accession#
NM_002958Protein Accession#
NP_002949Gene Name
RYK
Gene Alias
D3S3195, JTK5, JTK5A, RYK1
Gene Description
RYK receptor-like tyrosine kinase
Omim ID
600524Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an atypical member of the family of growth factor receptor protein tyrosine kinases, differing from other members at a number of conserved residues in the activation and nucleotide binding domains. This gene product belongs to a subfamily whose members do not appear to be regulated by phosphorylation in the activation segment. It has been suggested that mediation of biological activity by recruitment of a signaling-competent auxiliary protein may occur through an as yet uncharacterized mechanism. Two alternative splice variants have been identified, encoding distinct isoforms. [provided by RefSeq
Other Designations
JTK5A protein tyrosine kinase|hydroxyaryl-protein kinase
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com