RPS27A monoclonal antibody (M01), clone 3E2-E6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant RPS27A.
Immunogen
RPS27A (AAH01392, 1 a.a. ~ 156 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99)
Isotype
IgG1 Lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (42.9 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RPS27A monoclonal antibody (M01), clone 3E2-E6 Western Blot analysis of RPS27A expression in HL-60 ( Cat # L014V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — RPS27A
Entrez GeneID
6233GeneBank Accession#
BC001392Protein Accession#
AAH01392Gene Name
RPS27A
Gene Alias
CEP80, HUBCEP80, UBA80, UBCEP1, UBCEP80
Gene Description
ribosomal protein S27a
Omim ID
191343Gene Ontology
HyperlinkGene Summary
Ubiquitin, a highly conserved protein that has a major role in targeting cellular proteins for degradation by the 26S proteosome, is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin fused to an unrelated protein. This gene encodes a fusion protein consisting of ubiquitin at the N terminus and ribosomal protein S27a at the C terminus. When expressed in yeast, the protein is post-translationally processed, generating free ubiquitin monomer and ribosomal protein S27a. Ribosomal protein S27a is a component of the 40S subunit of the ribosome and belongs to the S27AE family of ribosomal proteins. It contains C4-type zinc finger domains and is located in the cytoplasm. Pseudogenes derived from this gene are present in the genome. As with ribosomal protein S27a, ribosomal protein L40 is also synthesized as a fusion protein with ubiquitin; similarly, ribosomal protein S30 is synthesized as a fusion protein with the ubiquitin-like protein fubi. Multiple alternatively spliced transcript variants that encode the same proteins have been identified.[provided by RefSeq
Other Designations
40S ribosomal protein S27a|ubiquitin and ribosomal protein S27a|ubiquitin carboxyl extension protein 80|ubiquitin-CEP80
-
Interactome
-
Pathway
-
Publication Reference
-
Altered dynamics of ubiquitin hybrid proteins during tumor cell apoptosis.
Han XJ, Lee MJ, Yu GR, Lee ZW, Bae JY, Bae YC, Kang SH, Kim DG.
Cell Death & Disease 2012 Jan; 3:e255.
Application:WB-Ce, Human, Hep3B.
-
The HBx protein of hepatitis B virus regulates the expression, intracellular distribution and functions of Ribosomal Protein S27a.
Fatima G, Mathan G, Kumar V.
The Journal of General Virology 2011 Dec; 93(Pt 4):706.
Application:IHC, Mouse, Mouse liver.
-
Chemoprevention with Aqueous Extract of Butea monosperma flowers results in normalization of nuclear morphometry and inhibition of a proliferation marker in liver tumors.
Mathan G, Fatima G, Saxena AK, Chandan BK, Jaggi BS, Gupta BD, Qazi GN, Balasundaram C, Anand Rajan KD, Kumar VL, Kumar V.
Phytotherapy Research 2011 Mar; 25(3):324.
Application:IHC-P, Mouse, Liver tumors.
-
Altered dynamics of ubiquitin hybrid proteins during tumor cell apoptosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com