RAF1 monoclonal antibody (M03), clone 1H4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RAF1.
Immunogen
RAF1 (AAH18119, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRVFLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAASLIGEELQVDF
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (39.93 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RAF1 monoclonal antibody (M03), clone 1H4. Western Blot analysis of RAF1 expression in rat brain.Western Blot (Cell lysate)
RAF1 monoclonal antibody (M03), clone 1H4. Western Blot analysis of RAF1 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of RAF1 expression in transfected 293T cell line by RAF1 monoclonal antibody (M03), clone 1H4.
Lane 1: RAF1 transfected lysate(73.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of RAF1 over-expressed 293 cell line, cotransfected with RAF1 Validated Chimera RNAi ( Cat # H00005894-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RAF1 monoclonal antibody (M03) clone 1H4 (Cat # H00005894-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between PDGFRB and RAF1. Huh7 cells were stained with anti-PDGFRB rabbit purified polyclonal 1:600 and anti-RAF1 mouse monoclonal antibody 1:100. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between BAD and RAF1. HeLa cells were stained with anti-BAD rabbit purified polyclonal 1:1200 and anti-RAF1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — RAF1
Entrez GeneID
5894GeneBank Accession#
BC018119Protein Accession#
AAH18119Gene Name
RAF1
Gene Alias
CRAF, NS5, Raf-1, c-Raf
Gene Description
v-raf-1 murine leukemia viral oncogene homolog 1
Gene Ontology
HyperlinkGene Summary
This gene is the cellular homolog of viral raf gene (v-raf). The encoded protein is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. Once activated, the cellular RAF1 protein can phosphorylate to activate the dual specificity protein kinases MEK1 and MEK2, which in turn phosphorylate to activate the serine/threonine specific protein kinases, ERK1 and ERK2. Activated ERKs are pleiotropic effectors of cell physiology and play an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration. Mutations in this gene are associated with Noonan syndrome 5 and LEOPARD syndrome 2. [provided by RefSeq
Other Designations
Oncogene RAF1|raf proto-oncogene serine/threonine protein kinase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com