PSMB3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PSMB3 protein.
Immunogen
PSMB3 (NP_002786.2, 1 a.a. ~ 205 a.a) full-length human protein.
Sequence
MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PSMB3 MaxPab polyclonal antibody. Western Blot analysis of PSMB3 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of PSMB3 expression in transfected 293T cell line (H00005691-T01) by PSMB3 MaxPab polyclonal antibody.
Lane 1: PSMB3 transfected lysate(22.55 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to PSMB3 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PSMB3
Entrez GeneID
5691GeneBank Accession#
NM_002795.2Protein Accession#
NP_002786.2Gene Name
PSMB3
Gene Alias
HC10-II, MGC4147
Gene Description
proteasome (prosome, macropain) subunit, beta type, 3
Omim ID
602176Gene Ontology
HyperlinkGene Summary
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Pseudogenes have been identified on chromosomes 2 and 12. [provided by RefSeq
Other Designations
proteasome beta 3 subunit|proteasome chain 13|proteasome component C10-II|proteasome theta chain
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com