Product Browser

Last updated: 2014/4/14
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

PSMB3 polyclonal antibody (A01)

  • Catalog # : H00005691-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PSMB3.
  • Immunogen:
  • PSMB3 (AAH13008, 106 a.a. ~ 205 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAVSGMGVIVHIIEKDKITTRTLKARMD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00005691-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PSMB3 polyclonal antibody (A01), Lot # 051011JC01 Western Blot analysis of PSMB3 expression in HL-60 ( Cat # L014V1 ).
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 5691
  • Gene Name:
  • PSMB3
  • Gene Alias:
  • HC10-II,MGC4147
  • Gene Description:
  • proteasome (prosome, macropain) subunit, beta type, 3
  • Gene Summary:
  • The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Pseudogenes have been identified on chromosomes 2 and 12. [provided by RefSeq
  • Other Designations:
  • proteasome beta 3 subunit,proteasome chain 13,proteasome component C10-II,proteasome theta chain
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook