EIF2AK2 monoclonal antibody (M02), clone 1D11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EIF2AK2.
Immunogen
EIF2AK2 (NP_002750, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGN
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EIF2AK2 monoclonal antibody (M02), clone 1D11 Western Blot analysis of EIF2AK2 expression in K-562 ( Cat # L009V1 ).Western Blot (Transfected lysate)
Western Blot analysis of EIF2AK2 expression in transfected 293T cell line by EIF2AK2 monoclonal antibody (M02), clone 1D11.
Lane 1: EIF2AK2 transfected lysate(62.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to EIF2AK2 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EIF2AK2 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to EIF2AK2 on HeLa cell. [antibody concentration 30 ug/ml] -
Gene Info — EIF2AK2
Entrez GeneID
5610GeneBank Accession#
NM_002759Protein Accession#
NP_002750Gene Name
EIF2AK2
Gene Alias
EIF2AK1, MGC126524, PKR, PRKR
Gene Description
eukaryotic translation initiation factor 2-alpha kinase 2
Omim ID
176871Gene Ontology
HyperlinkGene Summary
interferon-inducible double stranded RNA dependent
Other Designations
OTTHUMP00000126954|double stranded RNA activated protein kinase|interferon-inducible elF2alpha kinase|protein kinase, interferon-inducible double stranded RNA dependent
-
Interactome
-
Disease
-
Publication Reference
-
PKR negatively regulates leukemia progression in association with PP2A activation, Bcl-2 inhibition and increased apoptosis.
Cheng X, Bennett RL, Liu X, Byrne M, Stratford May W.
Blood Cancer Journal 2013 Sep; 3(9):e144.
Application:WB-Tr, Human, REH, K562 cells.
-
PKR regulates proliferation, differentiation and survival of murine hematopoietic stem/progenitor cells.
Liu X, Bennett RL, Cheng X, Byrne M, Reinhard MK, May WS Jr.
Blood 2013 Apr; 121(17):3364.
Application:WB, Mouse, Mouse thymus, spleen, liver, kidney, bone marrow.
-
Increased expression of the dsRNA-activated protein kinase PKR in breast cancer promotes sensitivity to doxorubicin.
Bennett RL, Carruthers AL, Hui T, Kerney KR, Liu X, May WS Jr.
PLoS One 2012 Sep; 7(9):e46040.
Application:WB-Ce, Human, MCF-7, MDA-MB-231, T-47D cells.
-
PKR negatively regulates leukemia progression in association with PP2A activation, Bcl-2 inhibition and increased apoptosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com