Product Browser

Last updated: 2014/4/14

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

SERPINA1 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00005265-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human SERPINA1 protein.
  • Immunogen:
  • SERPINA1 (AAH15642.1, 1 a.a. ~ 418 a.a) full-length human protein.
  • Sequence:
  • MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQATTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SERPINA1 expression in transfected 293T cell line (H00005265-T01) by SERPINA1 MaxPab polyclonal antibody.

    Lane 1: SERPINA1 transfected lysate(46.7 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 5265
  • Gene Name:
  • SERPINA1
  • Gene Alias:
  • A1A,A1AT,AAT,MGC23330,MGC9222,PI,PI1,PRO2275
  • Gene Description:
  • serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
  • Gene Summary:
  • The protein encoded by this gene is secreted and is a serine protease inhibitor whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. Defects in this gene can cause emphysema or liver disease. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • protease inhibitor 1 (anti-elastase), alpha-1-antitrypsin,serine (or cysteine) proteinase inhibitor, clade A, member 1,serine proteinase inhibitor, clade A, member 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook