MDM2 monoclonal antibody (M01), clone 1A7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MDM2 expression in transfected 293T cell line by MDM2 monoclonal antibody (M01), clone 1A7.
Lane 1: MDM2 transfected lysate(55.2 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MDM2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 1.5 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MDM2 is approximately 0.03ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of MDM2 over-expressed 293 cell line, cotransfected with MDM2 Validated Chimera RNAi ( Cat # H00004193-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MDM2 monoclonal antibody (M01), clone 1A7 (Cat # H00004193-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between TP53 and MDM2. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-MDM2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MDM2.
Immunogen
MDM2 (NP_002383, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALC
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MDM2 expression in transfected 293T cell line by MDM2 monoclonal antibody (M01), clone 1A7.
Lane 1: MDM2 transfected lysate(55.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MDM2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 1.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MDM2 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of MDM2 over-expressed 293 cell line, cotransfected with MDM2 Validated Chimera RNAi ( Cat # H00004193-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MDM2 monoclonal antibody (M01), clone 1A7 (Cat # H00004193-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between TP53 and MDM2. HeLa cells were stained with anti-TP53 rabbit purified polyclonal 1:1200 and anti-MDM2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — MDM2
Entrez GeneID
4193GeneBank Accession#
NM_002392Protein Accession#
NP_002383Gene Name
MDM2
Gene Alias
HDMX, MGC71221, hdm2
Gene Description
Mdm2 p53 binding protein homolog (mouse)
Omim ID
164785Gene Ontology
HyperlinkGene Summary
This gene is a target gene of the transcription factor tumor protein p53. The encoded protein is a nuclear phosphoprotein that binds and inhibits transactivation by tumor protein p53, as part of an autoregulatory negative feedback loop. Overexpression of this gene can result in excessive inactivation of tumor protein p53, diminishing its tumor suppressor function. This protein has E3 ubiquitin ligase activity, which targets tumor protein p53 for proteasomal degradation. This protein also affects the cell cycle, apoptosis, and tumorigenesis through interactions with other proteins, including retinoblastoma 1 and ribosomal protein L5. More than 40 different alternatively spliced transcript variants have been isolated from both tumor and normal tissues. [provided by RefSeq
Other Designations
Mdm2, transformed 3T3 cell double minute 2, p53 binding protein|double minute 2, human homolog of; p53-binding protein|mouse double minute 2 homolog|p53-binding protein MDM2|ubiquitin-protein ligase E3 Mdm2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com