SMAD1 (Human) Recombinant Protein (Q03)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SMAD1 partial ORF (NP_005891.1, 176 a.a. - 259 a.a.) recombinant protein with GST tag at N-terminal.
Sequence
FQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGD
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.87
Interspecies Antigen Sequence
Mouse (95)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SMAD1
Entrez GeneID
4086GeneBank Accession#
NM_005900.2Protein Accession#
NP_005891.1Gene Name
SMAD1
Gene Alias
BSP1, JV4-1, JV41, MADH1, MADR1
Gene Description
SMAD family member 1
Omim ID
601595Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, this protein can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of this protein forms a complex with SMAD4, which is important for its function in the transcription regulation. This protein is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq
Other Designations
MAD, mothers against decapentaplegic homolog 1|Mad-related protein 1|SMAD, mothers against DPP homolog 1|Sma- and Mad-related protein 1|TGF-beta signaling protein 1|mothers against DPP homolog 1|transforming growth factor-beta signaling protein 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com