Product Browser

Last updated: 2015/4/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ITGAM (Human) Recombinant Protein (Q01)

  • Catalog # : H00003684-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ITGAM partial ORF ( NP_000623, 111 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003684-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3684
  • Gene Name:
  • ITGAM
  • Gene Alias:
  • CD11B,CR3A,MAC-1,MAC1A,MGC117044,MO1A,SLEB6
  • Gene Description:
  • integrin, alpha M (complement component 3 receptor 3 subunit)
  • Gene Summary:
  • This gene encodes the integrin alpha M chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as macrophage receptor 1 ('Mac-1'), or inactivated-C3b (iC3b) receptor 3 ('CR3'). The alpha M beta 2 integrin is important in the adherence of neutrophils and monocytes to stimulated endothelium, and also in the phagocytosis of complement coated particles. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • antigen CD11b (p170),complement component receptor 3, alpha,integrin alpha M,macrophage antigen alpha polypeptide,neutrophil adherence receptor alpha-M subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook