Product Browser

Last updated: 2015/5/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL2RG (Human) Recombinant ProteinProteoliposome

  • Catalog # : H00003561-G01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL2RG full-length ORF (NP_000197.1) recombinant protein without tag.
  • Sequence:
  • MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 42.3
  • Form:
  • Liquid
  • Storage Buffer:
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Antibody Production
  • Functional Study
  • Recommended usage only, not validated yet.
  • Compound Screening
  • Recommended usage only, not validated yet.
  • Application Image
  • Antibody Production
  • Functional Study
  • Compound Screening
  • Gene Information
  • Entrez GeneID:
  • 3561
  • Gene Name:
  • IL2RG
  • Gene Alias:
  • CD132,IMD4,SCIDX,SCIDX1
  • Gene Description:
  • interleukin 2 receptor, gamma (severe combined immunodeficiency)
  • Gene Summary:
  • The interleukin 2 (IL2) receptor gamma chain (IL2RG), an important signalling component of many interleukin receptors (IL2,IL4,IL7,IL9, and IL15), is thus referred to as the common gamma chain. Mutations in this X-chromosome-linked gene cause X-linked severe combined immunodeficiency (XSCID). [provided by RefSeq
  • Other Designations:
  • common cytokine receptor gamma chain,interleukin 2 receptor gamma chain,interleukin 2 receptor, gamma
  • RSS
  • YouTube
  • Linkedin
  • Facebook