HSF1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant HSF1.
Immunogen
HSF1 (NP_005517, 420 a.a. ~ 529 a.a) partial recombinant protein with GST tag.
Sequence
PSVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (86)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HSF1 polyclonal antibody (A01), Lot # 051026JC01 Western Blot analysis of HSF1 expression in Y-79 ( Cat # L042V1 ).Western Blot (Cell lysate)
HSF1 polyclonal antibody (A01), Lot # 060726QCS1. Western Blot analysis of HSF1 expression in Jurkat.Western Blot (Recombinant protein)
ELISA
-
Gene Info — HSF1
Entrez GeneID
3297GeneBank Accession#
NM_005526Protein Accession#
NP_005517Gene Name
HSF1
Gene Alias
HSTF1
Gene Description
heat shock transcription factor 1
Omim ID
140580Gene Ontology
HyperlinkGene Summary
The product of this gene is a heat-shock transcription factor. Transcription of heat-shock genes is rapidly induced after temperature stress. Hsp90, by itself and/or associated with multichaperone complexes, is a major repressor of this gene. [provided by RefSeq
Other Designations
-
-
Interactome
-
Publication Reference
-
Melatonin activates ABCA1 via the BiP/NRF1 pathway to suppress high-cholesterol-induced apoptosis of mesenchymal stem cells.
Jun Sung Kim, Young Hyun Jung, Hyun Jik Lee, Chang Woo Chae, Gee Euhn Choi, Jae Ryong Lim, Seo Yihl Kim, Joo Eun Lee, Ho Jae Han.
Stem Cell Research & Therapy 2021 Feb; 12(1):114.
Application:WB-Ce, Human, Human umbilical cord blood-derived mesenchymal stem cells.
-
Aqueous Extract of Paeonia lactiflora and Paeoniflorin as Aggregation Reducers Targeting Chaperones in Cell Models of Spinocerebellar Ataxia 3.
Chang KH, Chen WL, Lee LC, Lin CH, Kung PJ, Lin TH, Wu YC, Wu YR, Chen YC, Lee-Chen GJ, Chen CM.
Evidence-Based Complementary and Alternative Medicine 2013 Feb; 2013:471659.
Application:WB, Human, 293 cells.
-
Proinvasion metastasis drivers in early-stage melanoma are oncogenes.
Scott KL, Nogueira C, Heffernan TP, van Doorn R, Dhakal S, Hanna JA, Min C, Jaskelioff M, Xiao Y, Wu CJ, Cameron LA, Perry SR, Zeid R, Feinberg T, Kim M, Vande Woude G, Granter SR, Bosenberg M, Chu GC, Depinho RA, Rimm DL, Chin L.
Cancer Cell 2011 Jul; 20:92.
Application:IF, Human, Melanoma.
-
Melatonin activates ABCA1 via the BiP/NRF1 pathway to suppress high-cholesterol-induced apoptosis of mesenchymal stem cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com