Product Browser

Last updated: 2015/3/1
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HMGB1 polyclonal antibody (A01)

  • Catalog # : H00003146-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant HMGB1.
  • Immunogen:
  • HMGB1 (NP_002119, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003146-A01
    Western Blot detection against Immunogen (36.01 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3146
  • Gene Name:
  • HMGB1
  • Gene Alias:
  • DKFZp686A04236,HMG1,HMG3,SBP-1
  • Gene Description:
  • high-mobility group box 1
  • Other Designations:
  • Amphoterin,OTTHUMP00000018199,OTTHUMP00000190860,Sulfoglucuronyl carbohydrate binding protein,high mobility group box 1,high mobility group protein 1,high-mobility group (nonhistone chromosomal) protein 1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook