GNS purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
GNS MaxPab rabbit polyclonal antibody. Western Blot analysis of GNS expression in human liver.
Western Blot (Tissue lysate)
GNS MaxPab rabbit polyclonal antibody. Western Blot analysis of GNS expression in mouse kidney.
Western Blot (Transfected lysate)
Western Blot analysis of GNS expression in transfected 293T cell line (H00002799-T02) by GNS MaxPab polyclonal antibody.
Lane 1: GNS transfected lysate(62.1 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human GNS protein.
Immunogen
GNS (NP_002067.1, 1 a.a. ~ 552 a.a) full-length human protein.
Sequence
MRLLPLAPGRLRRGSPRHLPSCSPALLLLVLGGCLGVFGVAAGTRRPNVVLLLTDDQDEVLGGMTPLKKTKALIGEMGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQEPNTFPAILRSMCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTLLSVDDLVEKLVKRLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLVANIDLGPTILDIAGYDLNKTQMDGMSLLPILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRFSKHLL
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GNS MaxPab rabbit polyclonal antibody. Western Blot analysis of GNS expression in human liver.Western Blot (Tissue lysate)
GNS MaxPab rabbit polyclonal antibody. Western Blot analysis of GNS expression in mouse kidney.Western Blot (Transfected lysate)
Western Blot analysis of GNS expression in transfected 293T cell line (H00002799-T02) by GNS MaxPab polyclonal antibody.
Lane 1: GNS transfected lysate(62.1 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — GNS
Entrez GeneID
2799GeneBank Accession#
NM_002076.2Protein Accession#
NP_002067.1Gene Name
GNS
Gene Alias
G6S, MGC21274
Gene Description
glucosamine (N-acetyl)-6-sulfatase
Gene Ontology
HyperlinkGene Summary
The product of this gene is a lysosomal enzyme found in all cells. It is involved in the catabolism of heparin, heparan sulphate, and keratan sulphate. Deficiency of this enzyme results in the accumulation of undegraded substrate and the lysosomal storage disorder mucopolysaccharidosis type IIID (Sanfilippo D syndrome). Mucopolysaccharidosis type IIID is the least common of the four subtypes of Sanfilippo syndrome. [provided by RefSeq
Other Designations
N-acetylglucosamine-6-sulfatase|glucosamine-6-sulfatase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com