Product Browser

Last updated: 2015/8/30

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GDNF (Human) Recombinant Protein (P01)

  • Catalog # : H00002668-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GDNF full-length ORF ( NP_000505.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 50.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002668-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2668
  • Gene Name:
  • GDNF
  • Gene Alias:
  • ATF1,ATF2,HFB1-GDNF
  • Gene Description:
  • glial cell derived neurotrophic factor
  • Gene Summary:
  • This gene encodes a highly conserved neurotrophic factor. The recombinant form of this protein was shown to promote the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. The encoded protein is processed to a mature secreted form that exists as a homodimer. The mature form of the protein is a ligand for the product of the RET (rearranged during transfection) protooncogene. In addition to the transcript encoding GDNF, two additional alternative transcripts encoding distinct proteins, referred to as astrocyte-derived trophic factors, have also been described. Mutations in this gene may be associated with Hirschsprung disease. [provided by RefSeq
  • Other Designations:
  • astrocyte-derived trophic factor,glial cell line derived neurotrophic factor,glial derived neurotrophic factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook