Product Browser

Last updated: 2014/4/14

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

FCGR2A (Human) Recombinant ProteinProteoliposome

  • Catalog # : H00002212-G01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FCGR2A full-length ORF (AAH20823.1) recombinant protein without tag.
  • Sequence:
  • MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGVIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.9
  • Form:
  • Liquid
  • Storage Buffer:
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Antibody Production
  • Functional Study
  • Recommended usage only, not validated yet.
  • Compound Screening
  • Recommended usage only, not validated yet.
  • Application Image
  • Antibody Production
  • Functional Study
  • Compound Screening
  • Gene Information
  • Entrez GeneID:
  • 2212
  • Gene Name:
  • FCGR2A
  • Gene Alias:
  • CD32,CD32A,CDw32,FCG2,FCGR2,FCGR2A1,FcGR,IGFR2,MGC23887,MGC30032
  • Gene Description:
  • Fc fragment of IgG, low affinity IIa, receptor (CD32)
  • Gene Summary:
  • This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • Fc fragment of IgG, low affinity IIa, receptor,Fc fragment of IgG, low affinity IIa, receptor for (CD32),Immunoglobulin G Fc receptor II,OTTHUMP00000032377
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook