FABP1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human FABP1 full-length ORF ( AAH32801, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
39.71
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — FABP1
Entrez GeneID
2168GeneBank Accession#
BC032801Protein Accession#
AAH32801Gene Name
FABP1
Gene Alias
FABPL, L-FABP
Gene Description
fatty acid binding protein 1, liver
Omim ID
134650Gene Ontology
HyperlinkGene Summary
FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq
Other Designations
Fatty acid-binding protein, liver
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Adipocyte fatty acid binding protein in a Caucasian population: a new marker of metabolic syndrome?
Stejskal D, Karpisek M.
European Journal of Clinical Investigation 2006 Aug; 36(9):621.
Application:ELISA, Human , Serum from patients with metabolic syndrome.
-
Adiponectin, Adipocyte Fatty Acid Binding Protein, and Epidermal Fatty Acid Binding Protein: Proteins Newly Identified in Human Breast Milk.
Bronsky J, Karpisek M, Bronska E, Pechova M, Jancikova B, Kotolova H, Stejskal D, Prusa R, Nevoral J.
Clinical Chemistry 2006 Jul; 52(9):1763.
Application:Func, Human, Skim milk samples.
-
Adipocyte fatty acid binding protein in a Caucasian population: a new marker of metabolic syndrome?
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com