FABP1 monoclonal antibody (M02), clone 5F7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of FABP1 expression in transfected 293T cell line by FABP1 monoclonal antibody (M02), clone 5F7.
Lane 1: FABP1 transfected lysate(14.2 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FABP1 is approximately 0.1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of FABP1 over-expressed 293 cell line, cotransfected with FABP1 Validated Chimera RNAi ( Cat # H00002168-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with FABP1 monoclonal antibody (M02), clone 5F7 (Cat # H00002168-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (39.71 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant FABP1.
Immunogen
FABP1 (AAH32801, 1 a.a. ~ 127 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (39.71 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FABP1 expression in transfected 293T cell line by FABP1 monoclonal antibody (M02), clone 5F7.
Lane 1: FABP1 transfected lysate(14.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FABP1 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of FABP1 over-expressed 293 cell line, cotransfected with FABP1 Validated Chimera RNAi ( Cat # H00002168-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with FABP1 monoclonal antibody (M02), clone 5F7 (Cat # H00002168-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — FABP1
Entrez GeneID
2168GeneBank Accession#
BC032801Protein Accession#
AAH32801Gene Name
FABP1
Gene Alias
FABPL, L-FABP
Gene Description
fatty acid binding protein 1, liver
Omim ID
134650Gene Ontology
HyperlinkGene Summary
FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq
Other Designations
Fatty acid-binding protein, liver
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com