ACE monoclonal antibody (M01), clone 6A4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ACE.
Immunogen
ACE (AAH36375, 592 a.a. ~ 701 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSDDFYNETETKIFLQFYDQTGIWDHGAPHLLPPSQARGTREAPVYM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (77); Rat (72)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACE is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — ACE
Entrez GeneID
1636GeneBank Accession#
BC036375Protein Accession#
AAH36375Gene Name
ACE
Gene Alias
ACE1, CD143, DCP, DCP1, MGC26566
Gene Description
angiotensin I converting enzyme (peptidyl-dipeptidase A) 1
Gene Ontology
HyperlinkGene Summary
This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies. Two most abundant alternatively spliced variants of this gene encode two isozymes - the somatic form and the testicular form that are equally active. Multiple additional alternatively spliced variants have been identified but their full length nature has not been determined. [provided by RefSeq
Other Designations
CD143 antigen|angiotensin I converting enzyme|angiotensin converting enzyme, somatic isoform|carboxycathepsin|dipeptidyl carboxypeptidase 1|kininase II|peptidase P|peptidyl-dipeptidase A|testicular ECA
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Phosphorylation of the eukaryotic translation initiation factor 4E-transporter (4E-T) by c-Jun N-terminal kinase promotes stress-dependent P-body assembly.
Cargnello M, Tcherkezian J, Dorn JF, Huttlin EL, Maddox PS, Gygi SP, Roux PP.
Molecular and Cellular Biology 2012 Nov; 32(22):4572.
Application:IF, Human, U2OS cells.
-
The dual organization of P-bodies revealed by immunoelectron microscopy and electron tomography.
Cougot N, Cavalier A, Thomas D, Gillet R.
Journal of Molecular Biology 2012 Jun; 420(1-2):17.
Application:IF, Human, HeLa cells.
-
Drosophila genome-wide RNAi screen identifies multiple regulators of HIF-dependent transcription in hypoxia.
Dekanty A, Romero NM, Bertolin AP, Thomas MG, Leishman CC, Perez-Perri JI, Boccaccio GL, Wappner P.
PLoS Genetics 2010 Jun; 6(6):e1000994.
Application:IF, Drosophila, S2R+ cells.
-
Phosphorylation of the eukaryotic translation initiation factor 4E-transporter (4E-T) by c-Jun N-terminal kinase promotes stress-dependent P-body assembly.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com