Product Browser

Last updated: 2014/4/21

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

CYP19A1 (Human) Recombinant Protein (P02)

  • Catalog # : H00001588-P02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CYP19A1 full-length ORF ( AAH35714, 48 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PGPGYCMGIGPLISHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKLGLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTNESGYVDVLTLLRRVMLDTSNTLFLRIPLDGTEIFTLTS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.55
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001588-P02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1588
  • Gene Name:
  • CYP19A1
  • Gene Alias:
  • ARO,ARO1,CPV1,CYAR,CYP19,MGC104309,P-450AROM
  • Gene Description:
  • cytochrome P450, family 19, subfamily A, polypeptide 1
  • Gene Summary:
  • This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and catalyzes the last steps of estrogen biosynthesis, three successive hydroxylations of the A ring of androgens. Mutations in this gene can result in either increased or decreased aromatase activity; the associated phenotypes suggest that estrogen functions both as a sex steroid hormone and in growth or differentiation. The gene expresses two transcript variants. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000162543,aromatase,cytochrome P450, family 19,cytochrome P450, subfamily XIX (aromatization of androgens),estrogen synthetase,flavoprotein-linked monooxygenase,microsomal monooxygenase
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook