CRX monoclonal antibody (M03), clone 2F12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CRX monoclonal antibody (M03), clone 2F12 Western Blot analysis of CRX expression in PC-12 ( Cat # L012V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CRX is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.19 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CRX.
Immunogen
CRX (NP_000545, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MMAYMNPGPHYSVNALALSGPSVDLMHQAVPYPSAPRKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCR
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (98); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.19 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CRX monoclonal antibody (M03), clone 2F12 Western Blot analysis of CRX expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CRX is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — CRX
Entrez GeneID
1406GeneBank Accession#
NM_000554Protein Accession#
NP_000545Gene Name
CRX
Gene Alias
CORD2, CRD, LCA7, OTX3
Gene Description
cone-rod homeobox
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined. [provided by RefSeq
Other Designations
cone-rod homeobox protein|orthodenticle homeobox 3
-
Interactome
-
Disease
-
Publication Reference
-
OTX2 and CRX rescue overlapping and photoreceptor-specific functions in the Drosophila eye.
Terrell D, Xie B, Workman M, Mahato S, Zelhof A, Gebelein B, Cook T.
Developmental Dynamics 2012 Jan; 241(1):215.
Application：IF, WB-Ti, Drosophila, Retina.
-
OTX2 and CRX rescue overlapping and photoreceptor-specific functions in the Drosophila eye.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com