Product Browser

Last updated: 2015/8/30

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

COX6B1 (Human) Recombinant Protein (P01)

  • Catalog # : H00001340-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human COX6B1 full-length ORF ( AAH01015, 1 a.a. - 86 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.20
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001340-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1340
  • Gene Name:
  • COX6B1
  • Gene Alias:
  • COX6B,COXG
  • Gene Description:
  • cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous)
  • Gene Summary:
  • Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. [provided by RefSeq
  • Other Designations:
  • cytochrome c oxidase subunit VIb,human cytochrome oxidase subunit VIb
  • RSS
  • YouTube
  • Linkedin
  • Facebook