COX6B1 monoclonal antibody (M02), clone 2D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of COX6B1 expression in transfected 293T cell line by COX6B1 monoclonal antibody (M02), clone 2D3.
Lane 1: COX6B1 transfected lysate(10.2 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged COX6B1 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.2 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant COX6B1.
Immunogen
COX6B1 (AAH01015, 1 a.a. ~ 86 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.2 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of COX6B1 expression in transfected 293T cell line by COX6B1 monoclonal antibody (M02), clone 2D3.
Lane 1: COX6B1 transfected lysate(10.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged COX6B1 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — COX6B1
Entrez GeneID
1340GeneBank Accession#
BC001015Protein Accession#
AAH01015Gene Name
COX6B1
Gene Alias
COX6B, COXG
Gene Description
cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous)
Omim ID
124089Gene Ontology
HyperlinkGene Summary
Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. [provided by RefSeq
Other Designations
cytochrome c oxidase subunit VIb|human cytochrome oxidase subunit VIb
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com