COX4I1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
COX4I1 MaxPab polyclonal antibody. Western Blot analysis of COX4I1 expression in human kidney.
Western Blot (Transfected lysate)
Western Blot analysis of COX4I1 expression in transfected 293T cell line (H00001327-T01) by COX4I1 MaxPab polyclonal antibody.
Lane 1: COX4I1 transfected lysate(18.59 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human COX4I1 protein.
Immunogen
COX4I1 (NP_001852.1, 1 a.a. ~ 169 a.a) full-length human protein.
Sequence
MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
COX4I1 MaxPab polyclonal antibody. Western Blot analysis of COX4I1 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of COX4I1 expression in transfected 293T cell line (H00001327-T01) by COX4I1 MaxPab polyclonal antibody.
Lane 1: COX4I1 transfected lysate(18.59 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — COX4I1
Entrez GeneID
1327GeneBank Accession#
NM_001861.2Protein Accession#
NP_001852.1Gene Name
COX4I1
Gene Alias
COX4, COXIV, MGC72016
Gene Description
cytochrome c oxidase subunit IV isoform 1
Omim ID
123864Gene Ontology
HyperlinkGene Summary
Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3' of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com