Product Browser

Last updated: 2014/4/21
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

CDKN2B polyclonal antibody (A01)

  • Catalog # : H00001030-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant CDKN2B.
  • Immunogen:
  • CDKN2B (AAH14469, 1 a.a. ~ 138 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MREENKGIPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001030-A01
    Western Blot detection against Immunogen (41.29 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1030
  • Gene Name:
  • CDKN2B
  • Gene Alias:
  • CDK4I,INK4B,MTS2,P15,TP15,p15INK4b
  • Gene Description:
  • cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
  • Gene Summary:
  • This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq
  • Other Designations:
  • CDK inhibitory protein,CDK4B inhibitor,OTTHUMP00000021154,OTTHUMP00000021155,cyclin-dependent kinase 4 inhibitor B,cyclin-dependent kinase inhibitor 2B,cyclin-dependent kinases 4 and 6 binding protein,multiple tumor suppressor 2,p14_CDK inhibitor,p14_INK4
  • Interactome
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook