Product Browser

Last updated: 2014/4/14

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

CDK7 (Human) Recombinant Protein (P01)

  • Catalog # : H00001022-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CDK7 full-length ORF ( AAH00834.1, 1 a.a. - 346 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 63.58
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001022-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1022
  • Gene Name:
  • CDK7
  • Gene Alias:
  • CAK1,CDKN7,MO15,STK1,p39MO15
  • Gene Description:
  • cyclin-dependent kinase 7
  • Gene Summary:
  • The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. [provided by RefSeq
  • Other Designations:
  • 39 KDa protein kinase,Cdk-activating kinase,cell division protein kinase 7,cyclin-dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk-activating kinase),homolog of Xenopus MO15 Cdk-activating kinase,kinase subunit of CAK,serine/threonine kinase stk1,ser
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook